PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004505394.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 296aa    MW: 33700.7 Da    PI: 8.551
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004505394.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26099.62.9e-3117111195
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaC+++rrkC++dCvlapyfp ++ + ++ vhk+FG snv k+l++l+++ r++a++s  +eA ++a++Pv G +g +++  + + ql + l+
  XP_004505394.1  17 ACAACRHQRRKCTQDCVLAPYFPIDKIHVYESVHKVFGFSNVAKMLTKLDQQGRKQAIKSFEWEAMMWAQNPVFGPFGAYNEALNIITQLLTLLQ 111
                     7******************************************************************************9998888888766555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.24216117IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-3017111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MAKRNKPWNG SNTSNPACAA CRHQRRKCTQ DCVLAPYFPI DKIHVYESVH KVFGFSNVAK  60
MLTKLDQQGR KQAIKSFEWE AMMWAQNPVF GPFGAYNEAL NIITQLLTLL QQQQTFSTSE  120
PKFRGQAHDS LLFSNEALQV SNNVNWAPFV DNNNVVQNNP SFSYPYVHSF EGDLHNVEPK  180
IFNCVPDANV FLHQKSAILQ PNYFQNIASV SGSNNNVVTS STIDQQSQVR DFQCYDGNVE  240
NIYKTKGYGR EYAAVVQKSE KSIVDHTMAQ NRARSKIEEF QHPIYYSVGN SRPKQE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505394.10.0PREDICTED: LOB domain-containing protein 12-like
TrEMBLA0A072UMQ12e-55A0A072UMQ1_MEDTR; LOB domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF147861315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.17e-24LOB domain-containing protein 2